Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HTF-0106 | Recombinant Human Brn2-11R Protein | $300 |
| Product Name: | Recombinant Human Brn2-11R Protein |
| Catalog #: | HTF-0106 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Expression of the class III POU gene Brn-2, encoding the Brn-2/N-Oct-3 transcription factor, was first identified in mouse brain and is found to be widely expressed in the developing mammalian central nervous system. It has been shown that brn-2 is required for proper retinoic acid induced in vitro differentiation of P19 embryonic carcinoma cells to neural cells and is found predominantly expressed in postmitotic neurons of the mouse neocortex. Recent data demonstrated Brn2 (when combined with Ascl1 and Myt1L) plays a major role in transdifferentiation of human fibroblast cell into neuronal cells. Full-length human Brn2 cDNA was constructed with codon optimization using gene synthesis technology and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal and 11 Poly-Arginine (11R) tag at its C-terminal. (This construct deleted 18aa QQQQQQQQQQQQQQQQQQ when compared with wild-type Brn2 protein, NP_005595) It was expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | Brn2 (POUsF2) |
| Accession Number: | NP_005646 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT and others. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Thomas Vierbuchen et al. Direct conversion of fibroblasts to functional neurons by defined factors. NATURE. Vol 463/25 February 2010. Pp: 1035 – 1038. Hongyan Zhou, et al. Generation of Induced Pluripotent Stem Cells Using Recombinant Proteins. Cell Stem Cell. 2009. 4: 381-384. Vladimir Torchilin. Intracellular delivery of protein and peptide therapeutics. Drug Discovery Todays: Technologies. 2009.01.002, |
| Applications: | 1. May be used for in vitro Brn2 mediated gene transcription regulation study in human neuron cell’s differentiation by intracellular delivery of this Brn2-11R protein directly in vitro cell culture 2. May be used for mapping Bun2 protein-protein interaction. 3. May be used as specific substrate protein for kinase, and ubiquitin (Sumo pathway) related enzyme functional screening assays. 4. As native human Brn2 immunogen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYRE AHSLVQGDYGALHSNGHPLSHAHQWITALSHGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDEL HGPGALQQQHQQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPSMG ASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPPPQ GPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICR FEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFL KCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGV QTPVQESGGGGSPGRRRRRRRRRRR Download Datasheet |