Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-2815 | Recombinant Human UBE2E2 Protein | $300 |
| Product Name: | Recombinant Human UBE2E2 Protein |
| Catalog #: | HRP-2815 |
| Manufacture: | LD Biopharma, Inc. |
| Introduction: | Human Ubiquitin-Conjugating Enzyme E2 E2 (UBE2E2) gene encodes a E2 enzyme which accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Catalyzes the ISGylation of influenza A virus NS1 protein. Full-length human UBE2E2 cDNA (200aa) was constructed with codon optimization gene synthesis and expressed with a human N-terminalT7-His-TEV cleavage site Tag (31aa) fusion. This protein was expressed in E. coli as soluble one. The final product was purified using affinity column. |
| Gene Symbol: | UBE2E2 ( UBCH8 ) |
| Accession Number: | NP_689866 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile filtered, in 20% Glycerol / PBS buffer. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least two weeks. |
| Key Reference: | Chang,Y.H.,et al.,SETDB1 suppresses NK cell-mediated immunosurveillance in acute myeloid leukemia with granulo-monocytic differentiation. Cell Rep 43 (8), 114536 (2024) Hong,X.,et al., UBE2E2 enhances Snail-mediated epithelial-mesenchymal transition and Nrf2-mediated antioxidant activity in ovarian cancer. Cell Death Dis 14 (2), 100 (2023)
|
| Applications: |
|
| Quality Control: | Purity: > 92 % by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFGSSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT |