Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-2836 | Recombinant Human UBE2C Protein | $200 |
| Product Name: | Recombinant Human UBE2C Protein |
| Catalog #: | HRP-2836 |
| Manufacture: | LD Biopharma, Inc. |
| Introduction: | Human Ubiquitin-Conjugating Enzyme E2 C (UBE2C) gene encodes a E2 enzyme which accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, it catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. UBE2C acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. UBE2C acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.
|
| Gene Symbol: | UBE2C ( UBCH10 ) |
| Accession Number: | NP_008950 |
| Species: | Human |
| Package Size: | 25 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20% Glycerol / PBS buffer. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least two weeks. |
| Key Reference: | Rape M.,, et al.,Autonomous regulation of the anaphase-promoting complex couples mitosis to S-phase entry. Nature. Dec 2;432(7017):588-95.(2004) doi: 10.1038/nature03023. Epub 2004 Nov 21. Jiang,Y., et al.,UBE2C regulates the KEAP1/NRF2 signaling pathway to promote the growth of gastric cancer by inhibiting autophagy. Int J Biol Macromol 276 (Pt 2), 134011 (2024)
|
| Applications: |
|
| Quality Control: | Purity: > 92 % by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP |