| Cata #: | Name of Product: | Price: |
| HRP-3158 | Recombinant Human CD143 Protein | $250 |

| Product Name: | Recombinant Human CD143 Protein |
| Catalog #: | HRP-3158 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human Angiotesin-Converting Enzyme ACE (also named as CD143) gene encodes a enzymatic trans-membrane protein which converts angiotensin I to angiotensin II by release of the terminal His-Leu, this results in an increase of the vasoconstrictor activity of angiotensin. It also able to inactivate bradykinin, a potent vasodilator. CD143 has also a glycosidase activity which releases GPI-anchored proteins from the membrane as soluble one by cleaving the mannose linkage in the GPI moiety. At least 4 isoforms of CD143 have been identified.
|
| Gene Symbol: | CD143 (ACE; DCP; DCP1) |
| Accession Number: | NP_690043 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least two weeks. |
| Key Reference: | Ghafouri-Fard S, et al.,Angiotensin converting enzyme: A review on expression profile and its association with human disorders with special focus on SARS-CoV-2 infection. Vascul. Pharmacol. 130, 106680 (2020) Danilov SM, Tissue ACE phenotyping in lung cancer. PLoS ONE 14 (12), e0226553 (2019) Cambien F, et al., Deletion polymorphism in the gene for angiotensin-converting enzymeis a potent risk factor for myocardial infarction. Nature 359 (6396), 641-644 (1992) |
| Applications: |
|
| Quality Control: | Purity: > 85 % by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFGSENLYFQGHPLLVPSQEASQQVTVTHGTSSQATTSSQTTTHQATAHQTSAQSPNLVTDEAEASKFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGSCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNS |