| Cata #: | Name of Product: | Price: |
| HTF-1907 | Recombinant Human PBX1 Protein | $250 |

| Product Name: | Recombinant Human PBX1 Protein |
| Catalog #: | HTF-1907 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human pre-B-cell leukemia transcription Factor 1 (PBX1) gene encodes a nuclear protein that belongs to the PBX homeobox family of transcriptional factors. It binds the sequence 5'-ATCAATCAA-3'. PBX1 acts as a transcriptional activator of PF4 in complex with MEIS1. It converted into a potent transcriptional activator by the (1;19) translocation. PBX1 may have a role in steroidogenesis and, subsequently, sexual development and differentiation. Isoform PBXb1 as part of a PDX1:PBX1b:MEIS2b complex in pancreatic acinar cells is involved in the transcriptional activation of the ELA1 enhancer; the complex binds to the enhancer B element and cooperates with the transcription factor 1 complex (PTF1) bound to the enhancer A element. Probably in complex with MEIS2, is involved in transcriptional regulation by KLF4. PBX1 acts as a transcriptional activator of NKX2-5 and a transcriptional repressor of CDKN2B. Together with NKX2-5, it is required for spleen development through a mechanism that involves CDKN2B repression.
|
| Gene Symbol: | PBX1 ( CAKUHED ) |
| Accession Number: | NP_002576.1 |
| Species: | Human |
| Package Size: | 30 µg / Vial |
| Composition: | 0.3 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, DTT, Sucrose and others. |
| Storage: | In liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least two weeks. |
| Key Reference: | Golonzhka O, et al., Pbx Regulates Patterning of the Cerebral Cortex in Progenitors andPostmitotic Neurons. Neuron 88 (6), 1192-1207 (2015) AUFeng Y, et al., Hematopoietic pre-B cell leukemia transcription factor interactingprotein is overexpressed in gastric cancer and promotes gastriccancer cell proliferation, migration, and invasion Cancer Sci. 106 (10), 1313-1322 (2015) Magnani L, et al., The pioneer factor PBX1 is a novel driver of metastatic progressionin ERalpha-positive breast cancer. Oncotarget 6 (26), 21878-21891 (2015) Shen-Hao Chao, et al., Identification of hemeodomain proteins, PBX1 and PREP1, involved in the transcription of murine leukemia virus. Molecular & Cell Biology 23(3): 831-841 (2013) |
| Applications: |
|
| Quality Control: | Purity: > 90 % by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEGPGSVHSDTSN |