| Cata #: | Name of Product: | Price: |
| HRP-2810 | Recombinant Human UBE2L6 Protein | $250 |

| Product Name: | Recombinant Human UBE2L6 Protein |
| Catalog #: | HRP-2810 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human Ubiqutin / ISG15-conjugating enzyme E2 L6 gene (UBE2L6) encodes an enzyme which catalyzes the covalent attachment of ubiquitin or ISG15 to other proteins. It Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. It promotes ubiquitination and subsequent proteasomal degradation of FLT3. UBE2L6 is dominantly expressed in NK cells.
Full-length human UBE2L6 cDNA (152aa, derived from BC032491) was constructed with codon optimization gene synthesis and expressed with a human N-terminalT7-His-TEV cleavage site Tag (29aa) fusion. This protein was expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | UBE2L6 ( UBCH8; RIG-B ) |
| Accession Number: | NP_004214 |
| Species: | Human |
| Package Size: | 30 µg / Vial |
| Composition: | 0.3 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT and other. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least two weeks. |
| Key Reference: | Lertsooksawat W, et al., Up-regulation of interferon-stimulated gene 15 and its conjugation machinery, UbE1L and UbcH8 expression by tumor necrosis factor-alpha through p38 MAPK and JNK signaling pathways in human lung carcinoma. Mol. Cell. Biochem. 462 (1-2), 51-59 (2019)
Zhang Q, et al.,UHRF1 epigenetically down-regulates UbcH8 to inhibit apoptosis in cervical cancer cells. Cell Cycle 17 (3), 300-308 (2018)
Falvey CM, et al., UBE2L6/UBCH8 and ISG15 attenuate autophagy in esophageal cancer cells. Oncotarget 8 (14), 23479-23491 (2017)
Nyman TA, et al., Proteome analysis reveals ubiquitin-conjugating enzymes to be a new family of interferon-alpha-regulated genes. Eur. J. Biochem. 267 (13), 4011-4019 (2000) |
| Applications: |
|
| Quality Control: | Purity: > 94 % by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS |