| Cata #: | Name of Product: | Price: |
| HRP-2738 | Recombinant Human YTHDF1 Protein | $300 |

| Product Name: | Recombinant Human YTHDF1 Protein |
| Catalog #: | HRP-2738 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human YTH domain-containing family protein-1 (YTHDF1) gene encodes an enzymatic protein, which specifically recognizes and binds N6-methyladenosine (m6A)-containing mRNAs, and promotes mRNA translation efficiency. The mRNA M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability. It acts as a regulator of mRNA translation efficiency: promotes ribosome loading to m6A-containing mRNAs and interacts with translation initiation factors eIF3 (EIF3A or EIF3B) to facilitate translation initiation. Recent publications indicated that YTHDF1 activities may regulate anti-tumor immunity in dendritic cells. Specific anti-YTHDF1 autoantibodies has also been detected in some patients. |
| Gene Symbol: | YTHDF1 ( C20orf21; DACA-1 ) |
| Accession Number: | NP_060268 |
| Species: | Human |
| Package Size: | 20 µg / Vial |
| Composition: | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT and others. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Dali Han, et al,.Anti-tumour immunity controlled through mRNA m6A methylation and YTHDF1 in dendritic cells. Nature. https://doi.Org/ 10.1038/s41586-019-0916-x (2019) Zhao X, et al,.Overexpression of YTHDF1 is associated with poor prognosis in patients with hepatocellular carcinoma. Cancer Biomark 21 (4), 859-868 (2018) Tirumuru N, et al., N(6)-methyladenosine of HIV-1 RNA regulates viral infection and HIV-1 Gag protein expression. Elife 5, e15528 (2016) |
| Applications: | 1. May be used for in vitro YTHDF1 mediated mRNA methylation regulation study in various signaling pathways for various cancer cells by intracellular delivery of this recombinant YTHDF1 protein using protein delivery reagent, such as ProFectin reagent kit. |
| Quality Control: | Purity: > 90 % by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFSATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYYPPSIGFPYSLNEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQPGFHSDTLSKAPGMNSLEQGMVGLKIGDVSSSAVKTVGSVVSSVALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ Download Datasheet |