| Cata #: | Name of Product: | Price: |
| HRP-1932 | Recombinant Human PDCD6 Protein | $300 |

| Product Name: | Recombinant Human PDCD6 Protein |
| Catalog #: | HRP-1932 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family. Calcium binding is important for homodimerization and for conformational changes required for binding to other protein partners. This gene product participates in T cell receptor-, Fas-, and glucocorticoid-induced programmed cell death. It may mediate Ca2+-regulated signals along the death pathway. Calcium-dependent adapter is necessary for the association between PDCD6IP and TSG101. PDCD6 interaction with DAPK1 can accelerate apoptotic cell death by increasing caspase-3 activity. It may inhibit KDR/VEGFR2-dependent angiogenesis; the function involves inhibition of VEGF-induced phosphoprylation of the Akt signaling pathway. PDCF6 seems to play a role in the regulation of the distribution and function of MCOLN1 in the endosomal pathway. Full-length human PDCD6 cDNA (190 aa, Isoform-I) was constructed with N-terminal codon optimization gene synthesis and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein was expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | PDCD6 (ALG-2; PEF1B) |
| Accession Number: | NP_037364 |
| Species: | Human |
| Package Size: | 20 µg / Vial |
| Composition: | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Zhou B, et al., Prognostic value of PDCD6 polymorphisms and the susceptibility to bladder cancer. Tumour Biol. 35 (8), 7547-7554 (2014) Sasaki-Osugi K, et al., Nuclear ALG-2 protein interacts with Ca2+ homeostasis endoplasmic reticulum protein (CHERP) Ca2+-dependently and participates in regulation of alternative splicing of inositol trisphosphate receptor type 1 (IP3R1) pre-mRNA. J. Biol. Chem. 288 (46), 33361-33375 (2013) Okumura M, et al., VPS37 isoforms differentially modulate the ternary complex formation of ALIX, ALG-2, and ESCRT-I. Biosci. Biotechnol. Biochem. 77 (8), 1715-1721 (2013) Okumura M, et al., Mammalian ESCRT-III-related protein IST1 has a distinctive met-pro repeat sequence that is essential for interaction with ALG-2 in the presence of Ca2+. Biosci. Biotechnol. Biochem. 77 (5), 1049-1054 (2013) |
| Applications: | 1. May be used for in vitro PDCD6 mediated Ca2+-regulated signals related cell death pathway regulation study in various cells by intracellular delivery of this protein using ProFectin reagent. 2. May be used for protein-protein interaction assay. 3. Potential biomarker protein for tumor treatment / prognosis. 4. As immunogen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGGEFAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV Download Datasheet |