| Cata #: | Name of Product: | Price: |
| PRP-2013 | Recombinant Prohevein Protein | $300 |

| Product Name: | Recombinant Prohevein Protein |
| Catalog #: | PRP-2013 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | PROHEVIEN gene encodes a protein which is the major soy allergen for patients allergic to para rubber tree products. Full-length PROHEVEIN (186aa) was constructed by codon-optimization gene synthesis technology with 29 aa N-terminal T7 / His / TEV cleavage site Tag. This gene was expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | PROHEVEIN |
| Accession Number: | O49860 |
| Species: | Glycine max (Soybean) |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Rozynek P., et al., "Cloning, expression and characterization of the major latex allergen prohevein"; Clin. Exp. Allergy 28(11):1418-1426. (1998). |
| Applications: | 1. May be used as “ research ” reagent for allergic detection assay development. 2. As a native extracellular domain, may be used as immunogen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGEFEQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKDSGEGVGGGSASNVLATYHLYNSQDHGWDLNAASAYCSTWDANKPYSWRSKYGWTAFCGPVGAHGQPSCGKCLSVTNTGTGAKATVRIVDQCSNGGLDLDVNVFRQLDTDGKGYERGHLTVNYQFVDCGDSFNPLFSVMKSSVIN Download Datasheet |