| Cata #: | Name of Product: | Price: | 
| hRP-0854 | Recombinant Human BCAS2 Protein | $300 | 

| Product Name: | Recombinant Human BCAS2 Protein | 
| Catalog #: | hRP-0854 | 
| Manufacture: | LD Biopharma, Inc. | 
| Intruduction: | The sequence of human breast cancer amplified sequence 2 (BCAS2) is the same as DAM1 (Mus musculus DNA amplified in mammary carcinoma mRNA; GenBank accession no. AB020623) deposited atNCBI data-base. Human BCAS2 gene maps to chromosome 1p13.3-21 region, which encodes 26 kDa protein. BCAS2 was recently characterized as a transcriptional cofactor that enhances estrogen receptor–mediated gene expression. Recent data also demonstrated that BCAS2 is negative regulator of p53 protein and hence a potential molecular target for cancer therapy. Full-length human BCAS2 (225 aa) gene was constructed with 15 aa N-terminal T7 tag and expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. | 
| Gene Symbol: | BCAS2 (DAM1; Snt309; SPF27) | 
| Accession Number: | NP_005863 | 
| Species: | Human | 
| Package Size: | 50 µg / Vial | 
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. | 
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. | 
| Key Reference: | Kuo,P.C., et al., Breast cancer amplified sequence 2, a novel negative regulator of the p53 tumor suppressor. Cancer Res. 69 (23), 8877-8885 (2009) Qi,C., et al., Potentiation of estrogen receptor transcriptional activity by breast cancer amplified sequence 2. Biochem. Biophys. Res. Commun. 328 (2), 393-398 (2005) | 
| Applications: | 1. May be used for in vitro wild-type P53 mediated cancer cell apoptosis regulation study with intracellular delivery of this protein. 2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development. 3. May be used for mapping BCAS2 protein-protein interaction. 4. May be used as antigen for specific antibody development. | 
| Quality Control: | Purity: > 90% by SDS-PAGE. | 
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFMAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF Download Datsheet |