| Cata #: | Name of Product: | Price: |
| hRP-0486 | Recombinant Human PPIH Protein | $300 |

| Product Name: | Recombinant Human PPIH Protein |
| Catalog #: | hRP-0486 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome. Full length human PPIH gene was constructed with N-terminal 17 aa (T7) tag. This protein was expressed in E. coli as inclusion bodies, refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | PPIH (CYP-20; CYPH; SnuCyp-20; USA_CYP) |
| Accession Number: | NP_006338 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Ingelfinger,D., et al,. Two protein-protein interaction sites on the spliceosome-associated human cyclophilin CypH. Nucleic Acids Res. 31 (16), 4791-4796 (2003) Horowitz,D.S., et al,. A cyclophilin functions in pre-mRNA splicing, EMBO J. 21 (3), 470-480 (2002) |
| Applications: | 1. May be used for human spliceosome regulation study in vitro, 2. May be used as specific substrate protein for kinase and ubiquitin enzymes. 3. May be used for enzymatic assay |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFGSAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM Download Datasheet |