Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-1607 | Recombinant Human CD83 Protein | $300 |
| Product Name: | Recombinant Human CD83 Protein |
| Catalog #: | HRP-1607 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The protein encoded by human CD83 gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation in dentritic cells. The membrane-bound CD83 is a well-known surface marker for mature DC and a soluble form of CD83 protein can bind to dendritic cells and inhibit their maturation. Recombinant extracellular domain of human CD83 extracellular domain cDNA (20 - 144 aa, derived from BC030830) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (35aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | CD83 (BL11; HB15) |
| Accession Number: | NP_004224 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Felix Bock, et al., Topical Application of Soluble CD83 Induces IDO-Mediated Immune Modulation, Increases Foxp3+ T cells, and Prolongs Allogeneic Corneal Graft Survival. Journal of Immunology. 191: 1965-1975 (2013)
Stein MF, et al., Multiple interferon regulatory factor and NF-kappaB sites cooperate in mediating cell-type- and maturation-specific activation of the human CD83 promoter in dendritic cells. Mol. Cell. Biol. 33 (7), 1331-1344 (2013) Chen L, et al., CD83-stimulated monocytes suppress T-cell immune responses through production of prostaglandin E2. PNAS. 15; 108 (46): 18778 - 83 (2011) |
| Applications: | 1. May be used for in vitro CD83 mediated T cell activation or DC inhibition regulation study with this protein as either coating matrix protein or soluble factor. 2. May be used for protein-protein interaction assay. 3. Potential biomarker protein for clinical monitoring NK cell function in vitro. 4. As antigen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGEFGSTSTPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAE Download Datasheet |