Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-1414 | Recombinant Human C4 Garma Protein | $300 |
| Product Name: | Recombinant Human C4 Garma Protein |
| Catalog #: | HRP-1414 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human C4 (Total 1744aa) gene encodes the acidic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor, which is proteolytically cleaved into a trimer of a, b, and g chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. Measurement of C4g chain protein concentration in blood sample may be beneficial for adjusting of treatment for Lupus patients. Full-length human C4 gamma domain cDNA ( 1454 – 1744 aa ) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | C4g |
| Accession Number: | NP_009224.2 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Kjaer TR, et al., Toward a structure-based comprehension of the lectin pathway of complement. Mol. Immunol. 56 (4), 413-422 (2013)
Perry AJ, et al., A molecular switch governs the interaction between the human complement protease C1s and its substrate, complement C4. J. Biol. Chem. 288 (22), 15821-15829 (2013) |
| Applications: | 1. May be used for in vitro human complement C4d mediated cancer cell resistant to complement-mediated damage pathway regulation study by using this protein as coating matrix protein or soluble factor. 2. May be used for protein-protein interaction assay. 3. Potential Diagnostic biomarker protein for tumors, such as lung cancer. 4. As antigen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGGEFEAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV Download Datasheet |