| Cata #: | Name of Product: | Price: | 
| HRP-1201 | Recombinant Human BAMBI Protein | $150 | 

| Product Name: | Recombinant Human BAMBI Protein | 
| Catalog #: | HRP-1201 | 
| Manufacture: | LD Biopharma, Inc. | 
| Intruduction: | Human BMP and Activin membrane-bound inhibitor homolog (BAMBI) gene encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encoded protein however is a pseudoreceptor, lacking an intracellular serine/threonine kinase domain required for signaling. Similar proteins in frog, mouse and zebrafish function as negative regulators of TGF-beta, which has led to the suggestion that the encoded protein may function to limit the signaling range of the TGF-beta family during early embryogenesis. Full-length extracellular domain of human BAMBI cDNA (21 – 152 aa) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. | 
| Gene Symbol: | BAMBI (NMA) | 
| Accession Number: | NP_036474.1 | 
| Species: | Human | 
| Package Size: | 50 µg / Vial | 
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. | 
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. | 
| Key Reference: | Subramaniam,N., et al., Metformin-mediated Bambi expression in hepatic stellate cells induces prosurvival Wnt/beta-catenin signaling. Cancer Prev Res (Phila) 5 (4), 553-561 (2012) Luo,X., et al., Identification of BMP and activin membrane-bound inhibitor (BAMBI) as a potent negative regulator of adipogenesis and modulator of autocrine/paracrine adipogenic factors. Diabetes 61 (1), 124-136 (2012) Wanninger,J., et al., Adiponectin induces the transforming growth factor decoy receptor BAMBI in human hepatocytes. FEBS Lett. 585 (9), 1338-1344 (2011) | 
| Applications: | 1. May be used for in vitro BAMBI protein mediated Wnt / b-catenin pathway regulation for either adipocytes or hepatocytes differentiation study with this protein as either coating matrix protein or soluble factor. 2. May be used for BAMBI protein-protein interaction assay. 3. As enzymatic substrate for various proteases. 4. As antigen for specific antibody production. | 
| Quality Control: | Purity: > 90% by SDS-PAGE. | 
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWFRA Download Datasheet |