| Cata #: | Name of Product: | Price: | 
| HRP-1082 | Recombinant Human VWC2 Protein | $300 | 

| Product Name: | Recombinant Human VWC2 Protein | 
| Catalog #: | HRP-1082 | 
| Manufacture: | LD Biopharma, Inc. | 
| Intruduction: | Human Brorin (Brain-specific chordin-like protein, or Von Willebrand factor C domain containing 2, VWC2) gene encodes a secreted bone morphogenic protein antagonist. The encoded protein is possibly involved in neural function and development and may play a role in cell adhesion. Full-length human VWC2 cDNA (27 -325aa, derived from BC110857) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. | 
| Gene Symbol: | VWC2 (Brorin; PSST739; UNQ739) | 
| Accession Number: | NP_940972 | 
| Species: | Human | 
| Package Size: | 50 µg / Vial | 
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. | 
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. | 
| Key Reference: | Zhang,J.L., et al., von Willebrand factor type C domain-containing proteins regulate bone morphogenetic protein signaling through different recognition mechanisms. J. Biol. Chem. 282 (27), 20002-20014 (2007) Koike,N., et al., Brorin, a novel secreted bone morphogenetic protein antagonist, promotes neurogenesis in mouse neural precursor cells. J. Biol. Chem. 282 (21), 15843-15850 (2007) | 
| Applications: | 1. May be used for in vitro Brorin (VWC2) mediated BMP signaling pathway regulation study for neurogenesis with this protein as either coating matrix protein or soluble factor. 2. May be used for Brorin protein-protein interaction assay. 3. As antigen for specific antibody production. | 
| Quality Control: | Purity: > 90% by SDS-PAGE. | 
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSPSIPLEKLAQAPEQPGQEKREHASRDGPGRVNELGRPARDEGGSGRDWKSKSGRGLAGREPWSKLKQAWVSQGGGAKAGDLQVRPRGDTPQAEALAAAAQDAIGPELAPTPEPPEEYVYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLCTEEGPLCAQPECPRLHPRCIHVDTSQCCPQCKERKNYCEFRGKTYQTLEEFVVSPCERCRCEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTICHCTYEEGTWRIERQAMCTRHECRQM Download Datasheet |