| Cata #: | Name of Product: | Price: |
| HRP-1139 | Recombinant Human CHAD Protein | $150 |

| Product Name: | Recombinant Human CHAD Protein |
| Catalog #: | HRP-1139 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human Chondroadherin (CHAD) is a cartilage matrix protein thought to mediate adhesion of isolated chondrocytes. The protein contains 11 leucine-rich repeats flanked by cysteine-rich regions. The chondroadherin messenger RNA is present in chondrocytes at all ages. Full-length mature form of human CHAD gene cDNA (23 - 359aa, derived from BC036360) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | CHAD (SLRR4A) |
| Accession Number: | NP_001258 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Haglund,L., et al., The C-terminal peptide of chondroadherin modulates cellular activity by selectively binding to heparan sulfate chains. J. Biol. Chem. 288 (2), 995-1008 (2013) Haglund,L., et al., Identification and characterization of the integrin alpha2 beta1 binding motif in chondroadherin mediating cell attachment. J. Biol. Chem. 286 (5), 3925-3934 (2011) Mansson,B., Association of chondroadherin with collagen type II. J. Biol. Chem. 276 (35), 32883-32888 (2001) |
| Applications: | 1. May be used for in vitro CHAD mediated chondrocytes differentiation regulation study with this protein as either coating matrix protein or soluble factor. 2. May be used as CHAD protein-protein interaction assay. 3. As enzymatic substrate for various proteases. 4. As native (non-glycosilated) antigen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGGEFCPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQRNNFPVLAANSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDDLTELTYLYLDHNKVTELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLETLALTNNPWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRH Download Datasheet |