| Cata #: | Name of Product: | Price: |
| HRP-1056 | Recombinant Human Vitronectin478 Protein | $250 |

| Product Name: | Recombinant Human Vitronectin478 Protein |
| Catalog #: | HRP-1056 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human VTN (Vitronectin) is a 478 amino acid protein (1-19 = signal domain), belongs to a member of the pexin family. Vitronectin is an abundant glycoprotein found in serum and the extracellular matrix and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond. Vitronectin has been speculated to be involved in homeostasis and tumor malignancy. The publication from Katherine’s paper indicated that full-length recombinant human vitronectin protein benefits long-term human ES cell culture when used as coating matrix protein. Human mature Vitronectin gene (478 aa) was constructed with codon optimization and expressed in non-fusion protein form in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. Coating this recombinant protein at 5-10 µg / well (6 well plate) in xeno-free NutriStem medium can be used for long-term human ES cells maintenance or human iPS cell generation in vitro. |
| Gene Symbol: | VTN |
| Accession Number: | NP_000629 |
| Species: | Human |
| Package Size: | 250 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation buffer containing sucrose, EDTA and DTT. |
| Storage: | In liquid. Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Katherine Wojcichowski, et al., Expression, production, and characterization of full-length vitronectin in Escherichia coli. Protein Expression and Purification 36, 131-138 (2004)
Stefan R. Braam. Et al. Recombinant Vitronectin is a Fucntionally Defined Substrate That Supports Human Embryonic Stem Cell Self-Renewal via aVb5 integrin. STEM CELLS. Vol 26. Issue 9. 2257-2265 (2008) Stefan Frank, et al., Small molecule-assisted, line-independent maintenance of human pluripotent stem cells in defined conditions. PlosOne. Vol:7, July,e41958 (2012) |
| Applications: | As coating matrix protein for human ES or iPS cell cultivation when combine with xeno-free cell culture media, such as NutriStem, FTDA or E8 culture medium for either cell maintenance or iPS generation in vitro. |
| Quality Control: | Purity: > 95% by SDS-PAGE. |
| Recombinant Protein Sequence: | MDQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL Download Datasheet |