| Cata #: | Name of Product: | Price: |
| HRP-0841 | Recombinant Human ARL4A Protein | $300 |

| Product Name: | Recombinant Human ARL4A Protein |
| Catalog #: | HRP-0841 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human ADP-ribosylation factor-like 4A (ARL4A) protein is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4A is similar to ARL4C and ARL4D and each has a nuclear localization signal and an unusually high guaninine nucleotide exchange rate. ARL4A is located in both the nuclear and extra-nuclear cell compartments. Multiple transcript variants encoding the same protein have been found for this gene. Recent data indicated that ARL4A plays a important role in ELMO-DOCK1800-Rac signaling pathway. Full-length human ARL4A (200 aa) gene was constructed with 15 aa N-terminal T7 tag and expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | ARL4A |
| Accession Number: | NP_005729 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Lin,Y.C., et al., ARL4A acts with GCC185 to modulate Golgi complex organization. J. Cell. Sci. 124 (PT 23), 4014-4026 (2011)
Patel,M., et al., The Arf family GTPase Arl4A complexes with ELMO proteins to promote actin cytoskeleton remodeling and reveals a versatile Ras-binding domain in the ELMO proteins family. J. Biol. Chem. 286 (45), 38969-38979 (2011) Chi,J.H., et al., Increased expression of the glioma-associated antigen ARF4L after loss of the tumor suppressor PTEN. Laboratory investigation. J. Neurosurg. 108 (2), 299-303 (2008). |
| Applications: | 1. May be used for in vitro actin cytoskeleton remodeling regulation study with intracellular delivery of this protein. 2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development. 3. May be used for mapping ARL4A protein-protein interaction. 4. Potential diagnostic biomarker for monitoring Akt/TOR pathway activity for various cancer. 5. May be used as antigen for specific antibody development. |
| Quality Control: | 1. Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFMGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR Download Datasheet |