Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| hRP-0896 | Recombinant Human KHK Protein | $300 |
| Product Name: | Recombinant Human KHK Protein |
| Catalog #: | hRP-0896 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human KHK gene encodes ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose, which associated with many metabolic states, such as glucose intolerance, hyperlipidaemia, obesity, insulin resistance et al. Full-length mature human KHK ( 298aa, Isoform-a ) gene was constructed with 15 aa N-terminal T7 tag and expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | KHK |
| Accession Number: | NP_000212 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Trinh,C.H., et al., Structures of alternatively spliced isoforms of human ketohexokinase. Acta Crystallogr. D Biol. Crystallogr. 65 (PT 3), 201-211 (2009) Cirillo,P., et al., Ketohexokinase-dependent metabolism of fructose induces proinflammatory mediators in proximal tubular cells. J. Am. Soc. Nephrol. 20 (3), 545-553 (2009) Hwa,J.S., et al., The expression of ketohexokinase is diminished in human clear cell type of renal cell carcinoma. Proteomics 6 (3), 1077-1084 (2006) |
| Applications: | 1. May be used for in vitro KHK mediated fructose metabolism regulation study with “ProFectin” based intracellular delivery of this protein. 2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development. 3. May be used for mapping KHK protein-protein interaction. 4. Potential diagnostic biomarker for renal cell carcinoma. 5. May be used as antigen for specific antibody development. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFMEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV Download Datasheet |