Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| hRP-1705 | Recombinant Human S100A9 Protein | $200 |
| Product Name: | Recombinant Human S100A9 Protein |
| Catalog #: | hRP-1705 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The protein encoded by human S100A9 gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members, which are located as a cluster on chromosome 1q21. S100A9 protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This anti-microbial protein exhibits antifungal and antibacterial activity. Recent data indicated that S100A9 may also plays roles in tumor development and inflammation pathway regulations. Full-length human S100A9 cDNA (113aa) was constructed using gene synthesis technology with codon optimization and expressed with a human Alpha-Fetal Protein N-terminal domain (AFPn)-His Tag (209aa) fusion at its N-terminal. This protein was expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | S100A9 (60B8Ag; CAGB; CFAG; CGLB; L1AG; MIF; NIF) |
| Accession Number: | NP_002956 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | van Bon L, et al., Proteomic analysis of plasma identifies the Toll-like receptor agonists S100A8/A9 as a novel possible marker for systemic sclerosis phenotype. Ann. Rheum. Dis. 73 (8), 1585-1589 (2014) Tidehag V, et al., High density of S100A9 positive inflammatory cells in prostate cancer stroma is associated with poor outcome. Eur. J. Cancer 50 (10), 1829-1835 (2014) Wang,Y., et al., Platelet-derived S100 family member myeloid-related protein-14 regulates thrombosis. J. Clin. Invest. 124 (5), 2160-2171 (2014) Wang L, et al., Functional characterization of S100A8 and S100A9 in altering monolayer permeability of human umbilical endothelial cells PLoS ONE 9 (3), E90472 (2014) |
| Applications: | 1. May be used for in vitro S100A9 mediated tumor cell differentiation / migration regulation study with this protein as either coating matrix protein or soluble factor. 2. May be used as S100A9 protein-protein interaction assay. 3. Potential biomarker for clinical applications such as monitoring cancer progress or systemic sclerosis development stages. 4. As antigen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDE QSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP Download Datasheet |