Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| rBP-1662 | Recombinant Streptavidin Protein | $80 |
| Product Name: | Recombinant Streptavidin Protein |
| Catalog #: | rBP-1662 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Streptavidin is a tetrameric protein secreted by Streptomyces avidinii, which binds firmly to biotin. Streptavidin is widely used in molecular biology through its unique high affinity for the vitamin biotin. The dissociation constant (Kd) of the biotin-streptavidin complex is about ~10-15 mol/L. The strong affinity recognition of biotin and biotinylated molecules has made streptavidin one of the most important components in diagnostics and laboratory kits. The streptavidin / biotin system has one of the biggest free energies of association of yet observed for non-covalent binding of a protein and small ligand in aqueous solution (K_assoc = 1014). The complexes are also extremely stable over a wide range of temperature and pH. Full-length Streptavidin cDNA was expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | Streptavidin |
| Accession Number: | X03591.1 |
| Species: | Streptomyces Avidinii |
| Package Size: | 500 µg / Vial |
| Composition: | 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Argarana,CE et al., Molecular cloning and nucleotide sequence of the streptavidin gene. Nucleic Acids Res., 14: 1871-1882. (1986) |
| Applications: | Can be used for assaying Biotin conjugated targets, such as protein, small molecular, and others in various detection technologies, |
| Quality Control: | 1. Purity: > 90% by SDS-PAGE. 2. Activity: > 17U / mg (one unit = streptavidin binds 1 μg D-biotin at pH 8.9). |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFDPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ Download Datasheet |