Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HTF-1637 | Recombinant Human TRAPPC2 Protein | $300 |
| Product Name: | Recombinant Human TRAPPC2 Protein |
| Catalog #: | HTF-1637 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The protein encoded by human trafficking protein particle complex 2 (TRAPPC2) gene is thought to be part of a large multi-subunit complex involved in the targeting and fusion of endoplasmic reticulum-to-Golgi transport vesicles with their acceptor compartment. In addition, the encoded protein can bind c-myc promoter-binding protein 1 and block its transcriptional repression capability. Mutations in this gene are a cause of spondyloepiphyseal dysplasia tarda (SEDT). Full-length human TRAPPC2 ( 139 aa, Isoform-II ) gene was constructed with 29 aa N-terminal T7 / His / TEV cleavage site Tag and expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | TRAPPC2 (HYP38334; MIP2A; SEDL; SEDT; TRAPPC2P1) |
| Accession Number: | NP_055378 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. |
| Key Reference: | Venditti R, et al., Sedlin controls the ER export of procollagen by regulating the Sar1 cycle. Science 337 (6102), 1668-1672 (2012) Duarte DT, et al., A yeast two hybrid screen identifies SPATA4 as a TRAPP interactor. FEBS Lett. 585 (17), 2676-2681 (2011) Jeyabalan J, et al., SEDLIN forms homodimers: characterisation of SEDLIN mutations and their interactions with transcription factors MBP1, PITX1 and SF1. PLoS ONE 5 (5), E10646 (2010) |
| Applications: | 1. May be used for in vitro TRAPPC2 mediated c-myc gene transcription regulation for various cells study with “ProFectin” reagent based intracellular delivery of this protein. 2. May be used as specific protein substrate for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays. 3. May be used for TRAPPC2 protein-protein interaction mapping. 4. As immunogen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFSGSFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGHMRFIMLHDIRQEDGIKNFFTDVYDLYIKFSMNPFYEPNSPIRSSAFDRKVQFLGKKHLLS Download Datasheet |