Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HTF-1611 | Recombinant Human IRF2 Protein | $300 |
| Product Name: | Recombinant Human IRF2 Protein |
| Catalog #: | HTF-1611 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human interferon regulatory factor 2 (IRF2) gene encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferon a and b, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4. Full-length human IRF2 (346 aa) gene was constructed with 29 aa N-terminal T7 / His / TEV cleavage site Tag and expressed in E.coli as inclusion bodies. It was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | IRF2 |
| Accession Number: | NP_002190.2 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. |
| Key Reference: | Cai YJ, et al., Up-regulation of intestinal epithelial cell derived IL-7 expression by keratinocyte growth factor through STAT1/IRF-1, IRF-2 pathway. PLoS ONE 8 (3), E58647 (2013)
Klune JR, et al., Interferon regulatory factor-2 is protective against hepatic ischemia-reperfusion injury. Am. J. Physiol. Gastrointest. Liver Physiol. 303 (5), G666-G673 (2012) Cui L, et al., IRF-2 is over-expressed in pancreatic cancer and promotes the growth of pancreatic cancer cells. Tumour Biol. 33 (1), 247-255 (2012) |
| Applications: | 1. May be used for in vitro IRF2 mediated gene transcription regulation study for interferon a and b production with “ProFectin” reagent based intracellular delivery of this protein. 2. May be used as specific protein substrate for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays. 3. May be used for IRF2 protein-protein interaction mapping. 4. Potential biomarker protein for monitoring liver damage or cancer progress. 5. As immunogen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGGSPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC Download Datasheet |