Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-0056 | Recombinant Human H2AX Protein | $300 |
| Product Name: | Recombinant Human H2AX Protein |
| Catalog #: | HRP-0056 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | H2AX is one of several genes coding for histone H2A. In cells, the DNA .is wrapped around histone-groups, consisting of core histones H2A, H2B, H3 and H4. Thus, the H2AX contributes to the histone-formation and therefore the structure of DNA. H2AX becomes phosphorylated on serine 139, then called gamma-H2AX, as a reaction on DNA Double-strand breaks (DSB). Gamma-H2AX is a sensitive target for looking at DSBs in cells. This full-length, non-fusion recombinant human H2AX protein was constructed and expressed in E. coli, refolded using our unique “temperature shift inclusion body refolding” technology and purified chromatographically.
|
| Gene Symbol: | H2AX |
| Accession Number: | NP_002096 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days. |
| Key Reference: | Rogakou,E.P., et al. DNA double-stranded breaks induce histone H2AX phosphorylation on serine 139. J. Biol. Chem. 273 (10), 5858-5868 (1998) |
| Applications: | 1. Soluble protein which may be used as substrate for enzymatic assay. 2. Active protein, for in vitro histone /DNA reconstitution assay. 3. As Immunogen for specific antibody production. |
| Quality Control: | 1. Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY Download Datasheet |