Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-0544 | Recombinant Human Cripto-1 Protein | $150 |
| Product Name: | Recombinant Human Cripto-1 Protein |
| Catalog #: | HRP-0544 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human teratocarcinoma-derived growth factor 1 (Cripto-1) gene encodes an epidermal growth factor-related protein that contains a cripto, FRL-1, and cryptic domain. The encoded protein is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. Mutations in this gene are associated with forebrain defects. Recent data indicated that human Cripto-1 protein plays a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.
Full-length mature human Cripto-1 cDNA (31-150aa, isoform-1, derived from BC067844) was constructed with codon optimization with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein was expressed in E. coli as inclusion bodies, refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | Cripto-1 (TDGF1; CR; CRGF) |
| Accession Number: | NP_003203 |
| Species: | Human |
| Package Size: | 20 ug / Vial |
| Composition: | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | De Luca,A., et al., Expression and functional role of CRIPTO-1 in cutaneous melanoma. Br. J. Cancer 105 (7), 1030-1038 (2011)
Brandt,R., et al., Identification and biological characterization of an epidermal growth factor-related protein: cripto-1. J. Biol. Chem. 269 (25), 17320-17328 (1994) Watanabe,K. et al., Intercellular transfer regulation of the paracrine activity of GPI-anchored Cripto-1 as a Nodal co-receptor. Biochem. Biophys. Res. Commun. 403 (1), 108-113 (2010) |
| Applications: | 1. May be used for in vitro Cripto-1/Nodal signaling pathway regulations study for mesoderm differentiation. 2. Potential biomarker protein for various cancer diagnostic developments. 3. May be used as antigen for specific antibody production. |
| Quality Control: | 1. Purity: > 90% by SDS-PAGE. 2. Activity: Measured by its binding ability in a functional ELSA. Immobilized recombinant human Nodal protein at 2ug/ml (100ul/well) can bind rhCripto-1 with a linear range of 0.5-100 ng/ml. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGGEFLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD Download Datasheet |