Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-1219 | Recombinant Human CD47 Protein | $200 |
| Product Name: | Recombinant Human CD47 Protein |
| Catalog #: | HRP-1219 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human CD47 gene encodes a five trans-membrane domain membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The longest extracellular domain of CD47, carry a single Ig-like V type domain. The CD47 is also a receptor for the C-terminal cell-binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Recent data indicated that various cancer cell over-expression of CD47 as “don’t eat me” signal for escaping phagocytosis in vivo. Blocking CD47 might be a specific targeting strategy for cancer immunotherapy. Full-length extracellular domain of human CD47, which carry single Ig-like V type domain cDNA (19 – 127 aa, derived from BC012884) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | CD47 (TAP, MER6, OA3) |
| Accession Number: | NP_001768.1 |
| Species: | Human |
| Package Size: | 50 ug / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Tseng,D., et al.,Anti-CD47 antibody-mediated phagocytosis of cancer by macrophages primes an effective antitumor T-cell response. Proc. Natl. Acad. Sci. U.S.A. 110 (27), 11103-11108 (2013)
Lascorz,J., et al., Association study identifying polymorphisms in CD47 and other extracellular matrix pathway genes as putative prognostic markers for colorectal cancer. Int J Colorectal Dis 28 (2), 173-181 (2013) |
| Applications: | 1. May be used for in vitro non-glycosylated CD47 longest extracellular domain protein mediated “don’t eat me” signal regulation study for cancer cell imgration, T cell activation et al. with this protein as either coating matrix protein or soluble factor. 2. May be used as CD47 protein-protein interaction assay. 3. As enzymatic substrate for various proteases. 4. As potential cancer diagnostic biomarker protein. 5. As antigen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETII Download Document |