Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-1046 | Recombinant Human TNFSF18 Protein | $150 |
| Product Name: | Recombinant Human TNFSF18 Protein |
| Catalog #: | HRP-1046 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The protein encoded by human tumor necrosis factor ligand superfamily member 18 (TNFSF18) gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells. Full-length extracellular domain of human TNFSF18 cDNA (72 - 199 aa, derived from BC074941) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal and expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | TNFSF18 (AITRL; GITRL;hGITRL; TL6) |
| Accession Number: | NP_005109.2 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Placke,T., et al., GITR ligand provided by thrombopoietic cells inhibits NK cell antitumor activity. J. Immunol. 189 (1), 154-160 (2012)
Byrne,A.M., et al., Induction of GITRL expression in human keratinocytes by Th2 cytokines and TNF-alpha: implications for atopic dermatitis. Clin. Exp. Allergy 42 (4), 550-559 (2012) Chen,M., et al., IFN-beta induces the proliferation of CD4+CD25+Foxp3+ regulatory T cells through upregulation of GITRL on dendritic cells in the treatment of multiple sclerosis. J. Neuroimmunol. 242 (1-2), 39-46 (2012) |
| Applications: | 1. May be used for in vitro TNFSF18 mediated regulatory T cells proliferation or activation regulations study with this protein as soluble factor. 2. May be used for TNFSF18 protein-protein interaction assay development. 3. May be used s potential therapeutic target for regulating T cell function such as psoriatic skin lesions treatment. 4. As antigen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGGEFQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS Download Datasheet |