| Cata #: | Name of Product: | Price: |
| HRP-1128 | Recombinant Human IGFBP1 Protein | $150 |

| Product Name: | Recombinant Human IGFBP1 Protein |
| Catalog #: | HRP-1128 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human insulin-like growth factor-binding protein 1 (IGFBP1) gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Recent data indicated that HMGA1-IGF1-IGFBP pathway plays an important role in modulating glucose uptake. Full-length mature protein of human IGFBP1 cDNA (25-259aa, derived from BC057806) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | IGFBP1 (AFBP; hIGFBP-1; IBP1; IGF-BP25; PP12) |
| Accession Number: | NP_000587 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Messmer-Blust,A.F., et al., RTEF-1 attenuates blood glucose levels by regulating insulin-like growth factor binding protein-1 in the endothelium. Circ. Res. 111 (8), 991-1001 (2012)
Iiritano,S., et al., The HMGA1-IGF-I/IGFBP system: a novel pathway for modulating glucose uptake. Mol. Endocrinol. 26 (9), 1578-1589 (2012) Park,H.I., et al., Peptide substrate specificities and protein cleavage sites of human endometase/matrilysin-2/matrix metalloproteinase-26. J. Biol. Chem. 277 (38), 35168-35175 (2002) |
| Applications: | 1. May be used for in vitro mediated IGF1 activity regulation study with this protein as either coating matrix protein or soluble factor. 2. May be used as IGFBP1 protein-protein interaction assay. 3. As enzymatic substrate for various proteases, such as MMP26, et al. 4. As antigen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGGEFAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN Download Datasheet |